Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC17A1 Peptide - N-terminal region

SLC17A1 Peptide - N-terminal region

Product Specifications

UniProt

E9PGW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC17A1 Rabbit Polyclonal Antibody (orb331286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFSD3 Human Gene Knockout Kit (CRISPR)
KN402293 1 Kit

MFSD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Benzyloxyphenylacetonitrile
TRC-B288963-500MG 500 mg

4-Benzyloxyphenylacetonitrile

Sign In for Pricing
View Details
P63 Rabbit Polyclonal Antibody
R1311-3 100 µL

P63 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNAP23 (NM_003825) Human Over-expression Lysate
LC401266 20 µg

SNAP23 (NM_003825) Human Over-expression Lysate

Sign In for Pricing
View Details
USP13 Human Gene Knockout Kit (CRISPR)
KN202190LP 1 Kit

USP13 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DRAK2 Polyclonal Antibody
E-AB-14744-01 20 µL

DRAK2 Polyclonal Antibody

Sign In for Pricing
View Details