Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICAL2 Peptide - C-terminal region

MICAL2 Peptide - C-terminal region

Product Specifications

UniProt

O94851

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MICAL2 Rabbit Polyclonal Antibody (orb586850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IMP1/IMPA1 Protein (His Tag)
PKSH032590-01 10 µg

Recombinant Human IMP1/IMPA1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IMP1/IMPA1 Protein (His Tag)
PKSH032590-02 50 µg

Recombinant Human IMP1/IMPA1 Protein (His Tag)

Sign In for Pricing
View Details
Ioxaglic Acid
TRC-I737400-10MG 10 mg

Ioxaglic Acid

Sign In for Pricing
View Details
BNIP3L (NM_004331) Human Over-expression Lysate
LC401379 20 µg

BNIP3L (NM_004331) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560166 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
ADAM 17 (Ab-735) Antibody
8B0763-AAT 50 µg

ADAM 17 (Ab-735) Antibody

Sign In for Pricing
View Details