MICAL2 Peptide - C-terminal region
MICAL2 Peptide - C-terminal region
Product Specifications
UniProt
O94851
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MICAL2 Rabbit Polyclonal Antibody (orb586850) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TCP1 delta (CCT4) Mouse Monoclonal Antibody [Clone ID: OTI4C9]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9089a7/imageurl/cf810867.webp)
CF810867 100 µg
TCP1 delta (CCT4) Mouse Monoclonal Antibody [Clone ID: OTI4C9]
Sign In for Pricing
View Details 
BNC473167-500 1x 500 µL
Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 