Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOBP Peptide - N-terminal region

MOBP Peptide - N-terminal region

Product Specifications

UniProt

G5E945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOBP Rabbit Polyclonal Antibody (orb585909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Flvcr1 shRNA (UAS) - Lentiviral mouse Flvcr1 shRNA (UAS, iRFP) (25)
GTR15127682 1 Vial

Lentiviral mouse Flvcr1 shRNA (UAS) - Lentiviral mouse Flvcr1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rat Tada1 Pre-designed siRNA Set B
SI214131B 1 Each

Rat Tada1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
Acetocarmine Plant Culture Tested
PCT1304-50ML 50 mL

Acetocarmine Plant Culture Tested

Sign In for Pricing
View Details