Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOBP Peptide - N-terminal region

MOBP Peptide - N-terminal region

Product Specifications

UniProt

G5E945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOBP Rabbit Polyclonal Antibody (orb585909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forskolin
S1612-5mg 5 mg

Forskolin

Sign In for Pricing
View Details
BI6727 (Volasertib)
A8558-5 5 mg

BI6727 (Volasertib)

Sign In for Pricing
View Details
Active Gremlin 1 (GREM1)
TRV-0005381-01 10 µg

Active Gremlin 1 (GREM1)

Sign In for Pricing
View Details
Active Gremlin 1 (GREM1)
TRV-0005381-02 50 µg

Active Gremlin 1 (GREM1)

Sign In for Pricing
View Details
Active Gremlin 1 (GREM1)
TRV-0005381-03 100 µg

Active Gremlin 1 (GREM1)

Sign In for Pricing
View Details
Active Gremlin 1 (GREM1)
TRV-0005381-04 200 µg

Active Gremlin 1 (GREM1)

Sign In for Pricing
View Details