AGAP5 Peptide - middle region
AGAP5 Peptide - middle region
Product Specifications
Product Name Alternative
CTGLF2
UniProt
A6NIR3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AGAP5 Rabbit Polyclonal Antibody (orb55727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001137472.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EMPEDIPLEPNPSDHPKASTIFLRKSQTDVQEKKKKQLCKVSTEHFTQQY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Serum Amyloid A (SAA1) Mouse Monoclonal Antibody [Clone ID: OTI4C10]](https://cdn.genprice.uk/products/937/68dd18bc061270361e90901b/imageurl/cf814063.webp)
CF814063 100 µg
Serum Amyloid A (SAA1) Mouse Monoclonal Antibody [Clone ID: OTI4C10]
Sign In for Pricing
View Details 
BNC680276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 