Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRCC3 Peptide - C-terminal region

BRCC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6.1A, BRCC36, CXorf53

UniProt

P46736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRCC3 Rabbit Polyclonal Antibody (orb331309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018065.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PDE9A Antibody
NBP1-00641SS 0.025 mL

Rabbit Polyclonal PDE9A Antibody

Sign In for Pricing
View Details
WDR24 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV635214 1.0 µg DNA

WDR24 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rac-1,2-Dilinolenoyl-3-chloropropanediol-d5
010129 2.5 mg

Rac-1,2-Dilinolenoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details
TRNAD4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2480308 1.0 µg DNA

TRNAD4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal ASK1 Antibody [DyLight 550]
NBP1-76674R 0.1 mL

Rabbit Polyclonal ASK1 Antibody [DyLight 550]

Sign In for Pricing
View Details
Rabbit Polyclonal ABHD13 Antibody
NBP1-88978 0.1 mL

Rabbit Polyclonal ABHD13 Antibody

Sign In for Pricing
View Details