Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIRAP3 Peptide - middle region

TIRAP3 Peptide - middle region

Product Specifications

Product Name Alternative

TAG, TIRAP3

UniProt

Q6JUT2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIRAP3 Rabbit Polyclonal Antibody (orb326690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157940

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRLREAQGRSRAEDLNTRVAYWHSVDTSPGYHESDSKKSEDLSLCNVAEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL
BNC880282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Dvl1 activation kit by CRISPRa
GA201153 1 Kit

Mouse Dvl1 activation kit by CRISPRa

Sign In for Pricing
View Details
Stambpl1 Mouse Gene Knockout Kit (CRISPR)
KN516830 1 Kit

Stambpl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF488A conjugate, 0.1mg/mL
BNC882205-500 1x 500 µL

PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cfl1 (NM_007687) Mouse Tagged ORF Clone
MG201348 10 µg

Cfl1 (NM_007687) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF405S conjugate, 0.1mg/mL
BNC041692-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details