Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIRAP3 Peptide - middle region

TIRAP3 Peptide - middle region

Product Specifications

Product Name Alternative

TAG, TIRAP3

UniProt

Q6JUT2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIRAP3 Rabbit Polyclonal Antibody (orb326690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157940

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRLREAQGRSRAEDLNTRVAYWHSVDTSPGYHESDSKKSEDLSLCNVAEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGRP2 (NM_001098671) Human Over-expression Lysate
LY420663 100 µg

RASGRP2 (NM_001098671) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Cyanophenylboronic Acid
TRC-C989690-5G 5 g

4-Cyanophenylboronic Acid

Sign In for Pricing
View Details
GFAP (GA-5), CF405S conjugate, 0.1mg/mL
BNC040167-100 1x 100 µL

GFAP (GA-5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHB) (beta) Rabbit Polyclonal Antibody
AP17400PU-N 400 µL

FSH beta (FSHB) (beta) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMOX2 Antibody
KC-13298-01 50 μL

HMOX2 Antibody

Sign In for Pricing
View Details
HMOX2 Antibody
KC-13298-02 100 µL

HMOX2 Antibody

Sign In for Pricing
View Details