KLK7 Peptide - middle region
KLK7 Peptide - middle region
Product Specifications
UniProt
P49862
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLK7 Rabbit Polyclonal Antibody (orb583688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT
More Discoveries
Explore Other Products
Browse additional items from our catalog
RG238451 10 µg
SMARCA6 (HELLS) (NM_001289074) Human Tagged ORF Clone
Sign In for Pricing
View Details 038929-Biotin 200 µL
NFE2, CT (NFE2, Transcription factor NF-E2 45kD subunit, Leucine zipper protein NF-E2, Nuclear factor, erythroid-derived 2 45kD subunit, p45 NF-E2) (Biotin) discontinued
Sign In for Pricing
View Details HLC23261-01 50 mg
6- (4-Bromothiophen-3-yl) -N-methylpyrimidin-4-amine
Sign In for Pricing
View Details