KLK7 Peptide - middle region
KLK7 Peptide - middle region
Product Specifications
UniProt
P49862
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLK7 Rabbit Polyclonal Antibody (orb583688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV740214 1.0 µg DNA
PHBP9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details MBS2085503-01 0.1 mL
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 6 (ADAM6)
Sign In for Pricing
View Details 
MBS2085503-02 0.2 mL
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 6 (ADAM6)
Sign In for Pricing
View Details 
MBS2085503-03 0.5 mL
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 6 (ADAM6)
Sign In for Pricing
View Details MBS2085503-04 1 mL
APC-Linked Polyclonal Antibody to A Disintegrin And Metalloprotease 6 (ADAM6)
Sign In for Pricing
View Details