Idua Peptide - middle region
Idua Peptide - middle region
Product Specifications
UniProt
D6REH5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IDUA Rabbit Polyclonal Antibody (orb585719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1582866-03 5x 100 Tests
Anti-Human CD271/NGFR Antibody (T-2), PE
Sign In for Pricing
View Details orb2388904 100 µL
Phospho-LATS1+LATS2 (Thr1079 +Thr1041) Rabbit Polyclonal Antibody (BF680)
Sign In for Pricing
View Details