Dusp11 Peptide - middle region
Dusp11 Peptide - middle region
Product Specifications
Product Name Alternative
2010300F21Rik, AI481497
UniProt
Q6NXK5
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dusp11 Rabbit Polyclonal Antibody (orb577606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_082375
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15179782 1 Vial
Lentiviral mouse Armc3 shRNA (UAS) - Lentiviral mouse Armc3 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details MBS2100536-01 5x 96 Tests
Rat Extracellular Matrix Metalloproteinase Inducer (EMMPRIN) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2100536-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Rat Extracellular Matrix Metalloproteinase Inducer (EMMPRIN) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2100536-03 10x 96 Tests
Rat Extracellular Matrix Metalloproteinase Inducer (EMMPRIN) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2100536-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Rat Extracellular Matrix Metalloproteinase Inducer (EMMPRIN) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details 
N2563-03-ML650 100 µL
Nicotinic Acetylcholine Receptor alpha 6 (cholinergic receptor, nicotinic, alpha 6 Precursor) (MaxLight 650) discontinued
Sign In for Pricing
View Details