Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp11 Peptide - middle region

Dusp11 Peptide - middle region

Product Specifications

Product Name Alternative

2010300F21Rik, AI481497

UniProt

Q6NXK5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dusp11 Rabbit Polyclonal Antibody (orb577606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082375

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (MaxLight 650)
252166-ML650 100 µL

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Transcriptional repressor CTCF (CTCF) ELISA Kit
GTR10349159 96 Well

Rabbit Transcriptional repressor CTCF (CTCF) ELISA Kit

Sign In for Pricing
View Details
Sorbin and SH3 domain-containing protein 1
AP88391 1 mg

Sorbin and SH3 domain-containing protein 1

Sign In for Pricing
View Details
DDX19B Rabbit Polyclonal Antibody
APRab09876-01 20 µL

DDX19B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX19B Rabbit Polyclonal Antibody
APRab09876-02 50 µL

DDX19B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX19B Rabbit Polyclonal Antibody
APRab09876-03 100 µL

DDX19B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details