STK17A Peptide - C-terminal region
STK17A Peptide - C-terminal region
Product Specifications
Product Name Alternative
DRAK1
UniProt
Q9UEE5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STK17A Rabbit Polyclonal Antibody (orb584150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004751
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SOX10 Recombinant Rabbit Monoclonal Antibody [PDH0-04]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80dc2/imageurl/ha721241.webp)
HA721241 100 µL
SOX10 Recombinant Rabbit Monoclonal Antibody [PDH0-04]
Sign In for Pricing
View Details 
BNC882379-500 1x 500 µL
HER-4 / ERBB4 (HFR-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
1322-AAT 2 Labelings
Buccutite™ Rapid PE-Cy5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*
Sign In for Pricing
View Details