Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK17A Peptide - C-terminal region

STK17A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DRAK1

UniProt

Q9UEE5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK17A Rabbit Polyclonal Antibody (orb584150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004751

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 Antibody
V2056IHC-7ML 7 mL

CD86 Antibody

Sign In for Pricing
View Details
CF®770-Dextran 10,000 MW, Anionic and Fixable
#80120 1x 1 mg

CF®770-Dextran 10,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
Mouse IgG2b (Immunoglobulin G2b) ELISA Kit
E-EL-M2399-01 24 Tests

Mouse IgG2b (Immunoglobulin G2b) ELISA Kit

Sign In for Pricing
View Details
Mouse IgG2b (Immunoglobulin G2b) ELISA Kit
E-EL-M2399-02 48 Tests

Mouse IgG2b (Immunoglobulin G2b) ELISA Kit

Sign In for Pricing
View Details
Mouse IgG2b (Immunoglobulin G2b) ELISA Kit
E-EL-M2399-03 96 Tests

Mouse IgG2b (Immunoglobulin G2b) ELISA Kit

Sign In for Pricing
View Details
CD19 (CVID3/429), 0.2mg/mL
BNUB0429-100 1x 100 µL

CD19 (CVID3/429), 0.2mg/mL

Sign In for Pricing
View Details