Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATL1 Peptide - C-terminal region

ATL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FSP1, GBP3, SPG3, HSN1D, SPG3A, AD-FSP, atlastin1

UniProt

Q8WXF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATL1 Rabbit Polyclonal Antibody (orb326517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cdc37 (NM_016742) AAV Particle
MR205904A1V 250 µL

Mouse Cdc37 (NM_016742) AAV Particle

Sign In for Pricing
View Details
Plastin L Recombinant Antibody, Biotin Conjugated
bsm-62866R-Biotin-TR 20 µL

Plastin L Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Cytokeratin pan Mouse mAb
orb1924344-01 50 µL

Cytokeratin pan Mouse mAb

Sign In for Pricing
View Details
Cytokeratin pan Mouse mAb
orb1924344-02 100 µL

Cytokeratin pan Mouse mAb

Sign In for Pricing
View Details
NDUFV3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
31672156 3x 1.0 µg DNA

NDUFV3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
AA (Arachidonic Acid) ValidElisa Kit
EK343374 96 Well

AA (Arachidonic Acid) ValidElisa Kit

Sign In for Pricing
View Details