Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATL1 Peptide - C-terminal region

ATL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FSP1, GBP3, SPG3, HSN1D, SPG3A, AD-FSP, atlastin1

UniProt

Q8WXF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATL1 Rabbit Polyclonal Antibody (orb326517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Recombinant Mouse Epcam Protein, Fc-tagged, Alexa Fluor 555 conjugated
Epcam-191MAF555 20 μg- 50 μg- 100 μg

Active Recombinant Mouse Epcam Protein, Fc-tagged, Alexa Fluor 555 conjugated

Sign In for Pricing
View Details
NAA10 Antibody
orb2674113-01 50 µL

NAA10 Antibody

Sign In for Pricing
View Details
NAA10 Antibody
orb2674113-02 100 µL

NAA10 Antibody

Sign In for Pricing
View Details
NAA10 Antibody
orb2674113-03 200 µL

NAA10 Antibody

Sign In for Pricing
View Details
Plac8 Mouse siRNA Oligo Duplex (Locus ID 231507)
SR401479 1 Kit

Plac8 Mouse siRNA Oligo Duplex (Locus ID 231507)

Sign In for Pricing
View Details
Ccnt1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6173603 1.0 µg DNA

Ccnt1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details