Runx1 Peptide - N-terminal region
Runx1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AI462102, AML1, Cbfa2, Pebp2a2, Pebpa2b
UniProt
Q03347
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Runx1 Rabbit Polyclonal Antibody (orb576453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033951
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPGELVRTDSPNFLCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ERPS6-100 100 Tests
EnzyFluo™ Human/Mouse RPS6 (S235/236) Phosphorylation ELISA
Sign In for Pricing
View Details 
BNC040902-100 1x 100 µL
Nucleolin (NCL/902), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 