Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN1 Peptide - N-terminal region

MFN1 Peptide - N-terminal region

Product Specifications

UniProt

Q8IWA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFN1 Rabbit Polyclonal Antibody (orb583673) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD107b Polyclonal Antibody
E-AB-70198-01 60 µL

CD107b Polyclonal Antibody

Sign In for Pricing
View Details
CD107b Polyclonal Antibody
E-AB-70198-02 120 µL

CD107b Polyclonal Antibody

Sign In for Pricing
View Details
CD107b Polyclonal Antibody
E-AB-70198-03 200 µL

CD107b Polyclonal Antibody

Sign In for Pricing
View Details
Endothelin 1 (EDN1) Rabbit Polyclonal Antibody
TA364228 50 µL

Endothelin 1 (EDN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNRPAB Recombinant Rabbit monoclonal Antibody
HA750996 100 µL

HNRPAB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Strn Mouse Gene Knockout Kit (CRISPR)
KN516914 1 Kit

Strn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details