Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN1 Peptide - N-terminal region

MFN1 Peptide - N-terminal region

Product Specifications

UniProt

Q8IWA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFN1 Rabbit Polyclonal Antibody (orb583673) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HS6ST3 activation kit by CRISPRa
GA116946 1 Kit

Human HS6ST3 activation kit by CRISPRa

Sign In for Pricing
View Details
Cyanine 647NS Succinimidyl Ester
#90119-1mg 1x 1 mg

Cyanine 647NS Succinimidyl Ester

Sign In for Pricing
View Details
BLNK Mouse Monoclonal Antibody [Clone ID: OTI4C9]
CF808517 100 µg

BLNK Mouse Monoclonal Antibody [Clone ID: OTI4C9]

Sign In for Pricing
View Details
Angptl7 Mouse Gene Knockout Kit (CRISPR)
KN501244 1 Kit

Angptl7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC22A8 Polyclonal Antibody
E-AB-16017-01 20 µL

SLC22A8 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A8 Polyclonal Antibody
E-AB-16017-02 60 µL

SLC22A8 Polyclonal Antibody

Sign In for Pricing
View Details