Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDAD1 Peptide - C-terminal region

SDAD1 Peptide - C-terminal region

Product Specifications

UniProt

Q9NVU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDAD1 Rabbit Polyclonal Antibody (orb331358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTKTNPFSSSTNKEKKKQKNFMMMRYSQNVRSKNKRSFREKQLALRDALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1PR2 Rabbit Polyclonal Antibody
AP01311PU-N 100 µg

S1PR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD22 Antibody
JOT20368F 20Tests

PE/Cyanine5 Anti-Mouse CD22 Antibody

Sign In for Pricing
View Details
GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC)
MBS6302942-01 0.2 mL

GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC)

Sign In for Pricing
View Details
GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC)
MBS6302942-02 5x 0.2 mL

GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC)

Sign In for Pricing
View Details
RANK (B-8) Alexa Fluor® 647
sc-390655 AF647 200 µg/mL

RANK (B-8) Alexa Fluor® 647

Sign In for Pricing
View Details
LCE1F shRNA Plasmid (h)
sc-88276-SH 20 µg

LCE1F shRNA Plasmid (h)

Sign In for Pricing
View Details