Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDAD1 Peptide - C-terminal region

SDAD1 Peptide - C-terminal region

Product Specifications

UniProt

Q9NVU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDAD1 Rabbit Polyclonal Antibody (orb331358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTKTNPFSSSTNKEKKKQKNFMMMRYSQNVRSKNKRSFREKQLALRDALL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AR- Alpha2A Polyclonal Antibody
BT-AP00651-01 20 µL

AR- Alpha2A Polyclonal Antibody

Sign In for Pricing
View Details
AR- Alpha2A Polyclonal Antibody
BT-AP00651-02 50 µL

AR- Alpha2A Polyclonal Antibody

Sign In for Pricing
View Details
AR- Alpha2A Polyclonal Antibody
BT-AP00651-03 100 µL

AR- Alpha2A Polyclonal Antibody

Sign In for Pricing
View Details
ALOX15 Mouse Monoclonal Antibody [Clone ID: LBI7H6]
AMM12378VCF 100 µg

ALOX15 Mouse Monoclonal Antibody [Clone ID: LBI7H6]

Sign In for Pricing
View Details
Mouse Anti Streptolysin O Antibody (IgM) ELISA Kit
MBS7255776-01 48 Strip Well

Mouse Anti Streptolysin O Antibody (IgM) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti Streptolysin O Antibody (IgM) ELISA Kit
MBS7255776-02 96 Strip Well

Mouse Anti Streptolysin O Antibody (IgM) ELISA Kit

Sign In for Pricing
View Details