Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A25 Peptide - C-terminal region

OR2A25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2A24P, OR2A25P, OR2A27

UniProt

A4D2G3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A25 Rabbit Polyclonal Antibody (orb327044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004488

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr736 (NM_001001384) Rat Tagged ORF Clone Lentiviral Particle
RR213015L4V 200 µL

Olr736 (NM_001001384) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) AKT1 Polyclonal Antibody
MBS7151197 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) AKT1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SIRP alpha/CD172a Antibody [PerCP]
NBP1-77045PCP 0.1 mL

Rabbit Polyclonal SIRP alpha/CD172a Antibody [PerCP]

Sign In for Pricing
View Details
Girdin Rabbit Polyclonal Antibody (BF350)
orb2413185 100 µL

Girdin Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
PQLC2 Over-expression Lysate Product
GWB-877761 0.1 mg

PQLC2 Over-expression Lysate Product

Sign In for Pricing
View Details
IL1B Polyclonal Antibody
A70712-100 100 µL

IL1B Polyclonal Antibody

Sign In for Pricing
View Details