Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2A25 Peptide - C-terminal region

OR2A25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2A24P, OR2A25P, OR2A27

UniProt

A4D2G3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2A25 Rabbit Polyclonal Antibody (orb327044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004488

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Relaxin 2 (RLN2) ELISA Kit
RK10084 96 Tests

Human Relaxin 2 (RLN2) ELISA Kit

Sign In for Pricing
View Details
TFIIIC90, NT (GTF3C4, General transcription factor 3C polypeptide 4, TF3C-delta, Transcription factor IIIC 90kD subunit, Transcription factor IIIC subunit delta) (AP) discontinued
042771-AP 200 µL

TFIIIC90, NT (GTF3C4, General transcription factor 3C polypeptide 4, TF3C-delta, Transcription factor IIIC 90kD subunit, Transcription factor IIIC subunit delta) (AP) discontinued

Sign In for Pricing
View Details
Monoclonal Antibody to Ephrin A4 (EFNA4)
TRV-0059643-01 20 µL

Monoclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Monoclonal Antibody to Ephrin A4 (EFNA4)
TRV-0059643-02 100 µL

Monoclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Monoclonal Antibody to Ephrin A4 (EFNA4)
TRV-0059643-03 200 µL

Monoclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Monoclonal Antibody to Ephrin A4 (EFNA4)
TRV-0059643-04 1 mL

Monoclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details