Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrc14 Peptide - C-terminal region

Lrrc14 Peptide - C-terminal region

Product Specifications

UniProt

Q6VB43

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC14 Rabbit Polyclonal Antibody (orb576974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EGF (Epidermal Growth Factor) CLIA Kit
E-CL-H0059-01 24 Tests

Human EGF (Epidermal Growth Factor) CLIA Kit

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) CLIA Kit
E-CL-H0059-02 48 Tests

Human EGF (Epidermal Growth Factor) CLIA Kit

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) CLIA Kit
E-CL-H0059-03 96 Tests

Human EGF (Epidermal Growth Factor) CLIA Kit

Sign In for Pricing
View Details
2-tert-Butyl-2-[2-(4-chlorophenyl)ethyl]oxirane
TRC-B810893-50MG 50 mg

2-tert-Butyl-2-[2-(4-chlorophenyl)ethyl]oxirane

Sign In for Pricing
View Details
Moesin (rMSN/492), 1mg/mL
BNUM2307-50 1x 50 µL

Moesin (rMSN/492), 1mg/mL

Sign In for Pricing
View Details
PPIAL4C (NM_001135789) Human Over-expression Lysate
LY427709 100 µg

PPIAL4C (NM_001135789) Human Over-expression Lysate

Sign In for Pricing
View Details