Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPHS1 Peptide - C-terminal region

SEPHS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPS, SELD, SPS1

UniProt

P49903

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPHS1 Rabbit Polyclonal Antibody (orb580505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182531.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-(+)-Maltose Monohydrate-UL-13C12
TRC-M160653-1MG 1 mg

D-(+)-Maltose Monohydrate-UL-13C12

Sign In for Pricing
View Details
Butyric Anhydride
TRC-B810000-250ML 250 mL

Butyric Anhydride

Sign In for Pricing
View Details
Spop Mouse Gene Knockout Kit (CRISPR)
KN516641 1 Kit

Spop Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPOCK3 (NM_001040159) Human Over-expression Lysate
LC421701 20 µg

SPOCK3 (NM_001040159) Human Over-expression Lysate

Sign In for Pricing
View Details
PERK (EIF2AK3) Human Gene Knockout Kit (CRISPR)
KN214993LP 1 Kit

PERK (EIF2AK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wsb2 Mouse Gene Knockout Kit (CRISPR)
KN519469 1 Kit

Wsb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details