Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPHS1 Peptide - C-terminal region

SEPHS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPS, SELD, SPS1

UniProt

P49903

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEPHS1 Rabbit Polyclonal Antibody (orb580505) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182531.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pancreas
CS621319 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Human YJEFN3 activation kit by CRISPRa
GA117787 1 Kit

Human YJEFN3 activation kit by CRISPRa

Sign In for Pricing
View Details
Primer Panel
HPP6001C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
UBE2QL1 Human Gene Knockout Kit (CRISPR)
KN426808 1 Kit

UBE2QL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Fluorophenylacetone
TRC-F595195-1G 1 g

3-Fluorophenylacetone

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF640R conjugate, 0.1mg/mL
BNC401930-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details