Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Peptide - middle region

MSRA Peptide - middle region

Product Specifications

UniProt

Q9UJ68

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSRA Rabbit Polyclonal Antibody (orb583285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal USP7 Antibody (OTI1F12) [DyLight 650]
NBP2-74814C 0.1 mL

Mouse Monoclonal USP7 Antibody (OTI1F12) [DyLight 650]

Sign In for Pricing
View Details
Jackbean meal
GRM091-500G 1 unit

Jackbean meal

Sign In for Pricing
View Details
Lentiviral human ST6GALNAC1 sgRNA gene knockout kit - Lentiviral human ST6GALNAC1 sgRNA gene knockout kit (100)
GTR15372289 1 Vial

Lentiviral human ST6GALNAC1 sgRNA gene knockout kit - Lentiviral human ST6GALNAC1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
FAM71B CRISPR/Cas9 KO Plasmid (h)
sc-408021 20 µg

FAM71B CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human HLA-DQ Monomorphic Antibody , APC
E55A08932 50 Tests

Human HLA-DQ Monomorphic Antibody , APC

Sign In for Pricing
View Details
GOSR2 Antibody
E309832 200 µL

GOSR2 Antibody

Sign In for Pricing
View Details