Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Peptide - middle region

MSRA Peptide - middle region

Product Specifications

UniProt

Q9UJ68

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSRA Rabbit Polyclonal Antibody (orb583285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-01 5 g

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details
4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-02 25 g

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details
4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-03 100 g

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details
4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-04 500 g

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details
4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-05 2.5 Kg

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details
Anti-human Latent TGF-β1 mAb (MT593), unconjugated
3550-3-250 250 µg

Anti-human Latent TGF-β1 mAb (MT593), unconjugated

Sign In for Pricing
View Details