COPS3 Peptide - C-terminal region
COPS3 Peptide - C-terminal region
Product Specifications
UniProt
Q9UNS2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COPS3 Rabbit Polyclonal Antibody (orb331035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15091949 1 Vial
Lentiviral human LAMTOR2 shRNA (UAS) - Lentiviral human LAMTOR2 shRNA (UAS) (25)
Sign In for Pricing
View Details 
MBS2142786-01 0.1 mL
FITC-Linked Polyclonal Antibody to Fetuin B (FETUB)
Sign In for Pricing
View Details MBS2142786-02 0.2 mL
FITC-Linked Polyclonal Antibody to Fetuin B (FETUB)
Sign In for Pricing
View Details MBS2142786-03 0.5 mL
FITC-Linked Polyclonal Antibody to Fetuin B (FETUB)
Sign In for Pricing
View Details MBS2142786-04 1 mL
FITC-Linked Polyclonal Antibody to Fetuin B (FETUB)
Sign In for Pricing
View Details