Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS3 Peptide - C-terminal region

COPS3 Peptide - C-terminal region

Product Specifications

UniProt

Q9UNS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPS3 Rabbit Polyclonal Antibody (orb331035) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SYTL4 shRNA (UAS) - Lentiviral human SYTL4 shRNA (UAS, RFP) (100)
GTR15348339 1 Vial

Lentiviral human SYTL4 shRNA (UAS) - Lentiviral human SYTL4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-Beta-Catenin
Y300249 100 μg/ 100 μL

Anti-Beta-Catenin

Sign In for Pricing
View Details
Mouse aldosterone,ALD ELISA KIT
JOT-EK0561Mo-01 48 Well

Mouse aldosterone,ALD ELISA KIT

Sign In for Pricing
View Details
Mouse aldosterone,ALD ELISA KIT
JOT-EK0561Mo-02 96 Well

Mouse aldosterone,ALD ELISA KIT

Sign In for Pricing
View Details
Trcg1 3'UTR GFP Stable Cell Line
TU171048 1.0 mL

Trcg1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Porcine Chemokine C-X-C-Motif Receptor 7 ELISA Kit
MBS100357-01 48 Well

Porcine Chemokine C-X-C-Motif Receptor 7 ELISA Kit

Sign In for Pricing
View Details