Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UHRF1 Peptide - C-terminal region

UHRF1 Peptide - C-terminal region

Product Specifications

UniProt

Q96T88

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UHRF1 Rabbit Polyclonal Antibody (orb574283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ZNF408 Antibody (PCRP-ZNF408-1E5) [DyLight 350]
NBP3-08324UV 100 µL

Mouse Monoclonal ZNF408 Antibody (PCRP-ZNF408-1E5) [DyLight 350]

Sign In for Pricing
View Details
Human Immunoglobulin E (IgE) ELISA Kit
orb1947705-01 48 Tests

Human Immunoglobulin E (IgE) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin E (IgE) ELISA Kit
orb1947705-02 96 Tests

Human Immunoglobulin E (IgE) ELISA Kit

Sign In for Pricing
View Details
TM9SF3 (NM_020123) Human Tagged Lenti ORF Clone
RC223270L4 10 µg

TM9SF3 (NM_020123) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GDF7 Polyclonal Antibody, APC Conjugated
bs-11461R-APC 100 µL

GDF7 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
WISP3 Protein Vector (Rat) (pPM-C-HA)
PV316604 500 ng

WISP3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details