Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UHRF1 Peptide - C-terminal region

UHRF1 Peptide - C-terminal region

Product Specifications

UniProt

Q96T88

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UHRF1 Rabbit Polyclonal Antibody (orb574283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perilipin-2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-10780R-BF555 100 µL

Perilipin-2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Human VCPIP1 Protein
E30P62306A 50 µg

Recombinant Human VCPIP1 Protein

Sign In for Pricing
View Details
Rat Retinoblastoma tumor suppressor protein ELISA Kit
MBS728541-01 48 Well

Rat Retinoblastoma tumor suppressor protein ELISA Kit

Sign In for Pricing
View Details
Rat Retinoblastoma tumor suppressor protein ELISA Kit
MBS728541-02 96 Well

Rat Retinoblastoma tumor suppressor protein ELISA Kit

Sign In for Pricing
View Details
Rat Retinoblastoma tumor suppressor protein ELISA Kit
MBS728541-03 5x 96 Well

Rat Retinoblastoma tumor suppressor protein ELISA Kit

Sign In for Pricing
View Details
Rat Retinoblastoma tumor suppressor protein ELISA Kit
MBS728541-04 10x 96 Well

Rat Retinoblastoma tumor suppressor protein ELISA Kit

Sign In for Pricing
View Details