Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARX2 Peptide - C-terminal region

BARX2 Peptide - C-terminal region

Product Specifications

UniProt

G3V397

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BARX2 Rabbit Polyclonal Antibody (orb576648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal anti-mouse IL-18 Receptor
mAP-0106 100 µg

Rat Monoclonal anti-mouse IL-18 Receptor

Sign In for Pricing
View Details
PDHA2 Antibody
E305373 100 µg - 200 µL

PDHA2 Antibody

Sign In for Pricing
View Details
Human Defensin Beta 124 (DEFb124) ELISA Kit
EK13638 48 Tests

Human Defensin Beta 124 (DEFb124) ELISA Kit

Sign In for Pricing
View Details
CHCHD10 CytoSection
TS409077P5 25 Slides

CHCHD10 CytoSection

Sign In for Pricing
View Details
Human Growth Differentiation Factor 9 ELISA Kit
MBS018590-01 48 Well

Human Growth Differentiation Factor 9 ELISA Kit

Sign In for Pricing
View Details
Human Growth Differentiation Factor 9 ELISA Kit
MBS018590-02 96 Well

Human Growth Differentiation Factor 9 ELISA Kit

Sign In for Pricing
View Details