Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARX2 Peptide - C-terminal region

BARX2 Peptide - C-terminal region

Product Specifications

UniProt

G3V397

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BARX2 Rabbit Polyclonal Antibody (orb576648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pkdcc Antibody Blocking peptide
orb1455746 500 µg

Mouse Pkdcc Antibody Blocking peptide

Sign In for Pricing
View Details
CYP3A4 Antibody
CSB-PA241465 100 µL

CYP3A4 Antibody

Sign In for Pricing
View Details
D6Wsu163e 3'UTR GFP Stable Cell Line
TU154811 1.0 mL

D6Wsu163e 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Dpep3 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7416502 1.0 µg DNA

Dpep3 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CAR discontinued
533976-01 30ul

CAR discontinued

Sign In for Pricing
View Details
CAR discontinued
533976-02 100 µL

CAR discontinued

Sign In for Pricing
View Details