Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7 Peptide - N-terminal region

TCF7 Peptide - N-terminal region

Product Specifications

UniProt

P36402

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCF7 Rabbit Polyclonal Antibody (orb577229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAM1 Recombinant Rabbit monoclonal Antibody [SA05-04]
ET1601-18-50UL 50 µL

VCAM1 Recombinant Rabbit monoclonal Antibody [SA05-04]

Sign In for Pricing
View Details
2-Chloronaphthalene
TRC-C373730-5G 5 g

2-Chloronaphthalene

Sign In for Pricing
View Details
2-Chloro Fenofibric Acid-d6
TRC-C364677-1MG 1 mg

2-Chloro Fenofibric Acid-d6

Sign In for Pricing
View Details
Impurity F: (Diol Imp.)1,1’-bis(carbethoxy)-4,4’-dihydroxy-4,4’bipiperidine
TRC-I172770-250MG 250 mg

Impurity F: (Diol Imp.)1,1’-bis(carbethoxy)-4,4’-dihydroxy-4,4’bipiperidine

Sign In for Pricing
View Details
RFP2 (TRIM13) (NM_213590) Human Recombinant Protein
TP309480L 1 mg

RFP2 (TRIM13) (NM_213590) Human Recombinant Protein

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL
BNC740488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details