HGFAC Peptide - C-terminal region
HGFAC Peptide - C-terminal region
Product Specifications
UniProt
D6RAR4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HGFAC Rabbit Polyclonal Antibody (orb324974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B212510-5MG 5 mg
Benzyl 2-Acetamido-2-deoxy-4-O-Beta-D-galactofuranosyl-Alpha-D-glucopyranoside
Sign In for Pricing
View Details 
TRC-C377570-250MG 250 mg
4-(p-Chloro-alpha-phenylbenzyl)-1-piperazineethanol Dihydrochloride
Sign In for Pricing
View Details 
#29117 1x 1 mL
Phaseolus Vulgaris Leucoagglutinin (PHA-L), CF®594 Conjugate
Sign In for Pricing
View Details 