Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP4K1 Peptide - N-terminal region

MAP4K1 Peptide - N-terminal region

Product Specifications

UniProt

B4E087

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKPKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 / MS4A1 (B-Cell Marker), 0.2mg/mL
BNUB1498-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker), 0.2mg/mL

Sign In for Pricing
View Details
TentaGel® B Boc / NH₂
B30132.12.1G 1 g

TentaGel® B Boc / NH₂

Sign In for Pricing
View Details
NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]
TA803354AM 100 µL

NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D11]

Sign In for Pricing
View Details
Netrin 1 (NTN1) Rabbit Polyclonal Antibody
TA367544 100 µL

Netrin 1 (NTN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPS15A (NM_001019) Human Over-expression Lysate
LC422673 20 µg

RPS15A (NM_001019) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF799 activation kit by CRISPRa
GA114036 1 Kit

Human ZNF799 activation kit by CRISPRa

Sign In for Pricing
View Details