Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP4K1 Peptide - N-terminal region

MAP4K1 Peptide - N-terminal region

Product Specifications

UniProt

B4E087

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKPKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
1-(3-Chlorophenyl)-1,2-propanedione
TRC-C379645-1G 1 g

1-(3-Chlorophenyl)-1,2-propanedione

Sign In for Pricing
View Details
Moxalactam Sodium Salt(Mixture of diastereomers)
TRC-M745600-250MG 250 mg

Moxalactam Sodium Salt(Mixture of diastereomers)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details