Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5F Peptide - N-terminal region

INPP5F Peptide - N-terminal region

Product Specifications

UniProt

Q9Y2H2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5F Rabbit Polyclonal Antibody (orb330799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM163A CRISPR/Cas9 KO Plasmid (m)
sc-435940 20 µg

FAM163A CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
TUBBP1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2559203 1.0 µg DNA

TUBBP1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Ribonucleotide Reductase M1 (RRM1) Magnetic Fluorescence Assay Kit
MBS2160308-01 96 Tests

Ribonucleotide Reductase M1 (RRM1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Ribonucleotide Reductase M1 (RRM1) Magnetic Fluorescence Assay Kit
MBS2160308-02 5x 96 Tests

Ribonucleotide Reductase M1 (RRM1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Ribonucleotide Reductase M1 (RRM1) Magnetic Fluorescence Assay Kit
MBS2160308-03 10x 96 Tests

Ribonucleotide Reductase M1 (RRM1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Clusterin alpha Chain Rabbit mAb
57245 Inquire

Clusterin alpha Chain Rabbit mAb

Sign In for Pricing
View Details