Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5F Peptide - N-terminal region

INPP5F Peptide - N-terminal region

Product Specifications

UniProt

Q9Y2H2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5F Rabbit Polyclonal Antibody (orb330799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axl Rabbit mAb
C05029-100uL 100 µL

Axl Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal LMW-PTP/ACP1 Antibody (5C11) [DyLight 680]
NBP2-59404FR 0.1 mL

Mouse Monoclonal LMW-PTP/ACP1 Antibody (5C11) [DyLight 680]

Sign In for Pricing
View Details
GPNMB Antibody - N-terminal region : FITC (ARP44499_P050-FITC)
ARP44499_P050-FITC 100 µL

GPNMB Antibody - N-terminal region : FITC (ARP44499_P050-FITC)

Sign In for Pricing
View Details
HAND2 Protein Lysate (Mouse) with C-HA Tag
22998034 100 µg

HAND2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Rac1/2/3/CDC42 Polyclonal Antibody
ABP52301-01 30 µL

Rac1/2/3/CDC42 Polyclonal Antibody

Sign In for Pricing
View Details
Rac1/2/3/CDC42 Polyclonal Antibody
ABP52301-02 100 µL

Rac1/2/3/CDC42 Polyclonal Antibody

Sign In for Pricing
View Details