OPN1LW Peptide - C-terminal region
OPN1LW Peptide - C-terminal region
Product Specifications
Product Name Alternative
RCP
UniProt
P04001, P04000, P0DN78, P0DN77
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OPN1LW Rabbit Polyclonal Antibody (orb584444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CDC37 Rabbit Monoclonal Antibody [Clone ID: 23GB3440]](https://cdn.genprice.uk/products/937/68dd1b62061270361ea130b0/imageurl/ta424636.webp)
TA424636 100 µL
CDC37 Rabbit Monoclonal Antibody [Clone ID: 23GB3440]
Sign In for Pricing
View Details 
