Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN1LW Peptide - C-terminal region

OPN1LW Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCP

UniProt

P04001, P04000, P0DN78, P0DN77

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN1LW Rabbit Polyclonal Antibody (orb584444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEZ1 Polyclonal Antibody
E-AB-66477-01 60 µL

FEZ1 Polyclonal Antibody

Sign In for Pricing
View Details
FEZ1 Polyclonal Antibody
E-AB-66477-02 120 µL

FEZ1 Polyclonal Antibody

Sign In for Pricing
View Details
FEZ1 Polyclonal Antibody
E-AB-66477-03 200 µL

FEZ1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human FGFBP2 Protein (Sumo Tag)
PDEH101150-01 20 µg

Recombinant Human FGFBP2 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human FGFBP2 Protein (Sumo Tag)
PDEH101150-02 100 µg

Recombinant Human FGFBP2 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human FGFBP2 Protein (Sumo Tag)
PDEH101150-03 500 µg

Recombinant Human FGFBP2 Protein (Sumo Tag)

Sign In for Pricing
View Details