CRISPLD1 Peptide - N-terminal region
CRISPLD1 Peptide - N-terminal region
Product Specifications
UniProt
B7Z8V9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CRISPLD1 Rabbit Polyclonal Antibody (orb326443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Major Basic Protein (PRG2) Mouse Monoclonal Antibody [Clone ID: OTI10D10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908e91/imageurl/cf813062.webp)
CF813062 100 µg
Major Basic Protein (PRG2) Mouse Monoclonal Antibody [Clone ID: OTI10D10]
Sign In for Pricing
View Details 
