OR4F4 Peptide - C-terminal region
OR4F4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OLA-7501, OR4F18
UniProt
Q96R69
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4F4 Rabbit Polyclonal Antibody (orb587597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004195
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF
More Discoveries
Explore Other Products
Browse additional items from our catalog
134798-ML650 100 µL
TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597, RP11-269C23.2) (MaxLight 650)
Sign In for Pricing
View Details 
K2664607 1.0 µg DNA
ZC3H10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 