Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGR Peptide - N-terminal region

PGR Peptide - N-terminal region

Product Specifications

Product Name Alternative

PR, NR3C3

UniProt

P06401

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGR Rabbit Polyclonal Antibody (orb573692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000917.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1R Antibody (C-term E487)
E45R05750G-4 50 µL

IL1R Antibody (C-term E487)

Sign In for Pricing
View Details
Tbata (NM_023064) Mouse Tagged ORF Clone
MG223783 10 µg

Tbata (NM_023064) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RNF165 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9258R-PerCP-Cy5.5 100 µL

RNF165 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rat Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit
DL-LOX1-Ra-01 48 Tests

Rat Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit

Sign In for Pricing
View Details
Rat Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit
DL-LOX1-Ra-02 96 Tests

Rat Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1) ELISA Kit

Sign In for Pricing
View Details
INMT Human Gene Knockout Kit (CRISPR)
KN418678 1 Kit

INMT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details