Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF746 Peptide - N-terminal region

ZNF746 Peptide - N-terminal region

Product Specifications

UniProt

Q6NUN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF746 Rabbit Polyclonal Antibody (orb577216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SVOP (NM_018711) Human Over-expression Lysate
LC402709 20 µg

SVOP (NM_018711) Human Over-expression Lysate

Sign In for Pricing
View Details
GST3 (GSTP1) Rabbit Polyclonal Antibody
TA384350 100 µL

GST3 (GSTP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSMD9 (NM_002813) Human Over-expression Lysate
LY419093 100 µg

PSMD9 (NM_002813) Human Over-expression Lysate

Sign In for Pricing
View Details
POP1 (NM_001145860) Human Over-expression Lysate
LC429037 20 µg

POP1 (NM_001145860) Human Over-expression Lysate

Sign In for Pricing
View Details
EPI (Epinephrine/Adrenaline) ELISA Kit
E-EL-0045-01 24 Tests

EPI (Epinephrine/Adrenaline) ELISA Kit

Sign In for Pricing
View Details
EPI (Epinephrine/Adrenaline) ELISA Kit
E-EL-0045-02 48 Tests

EPI (Epinephrine/Adrenaline) ELISA Kit

Sign In for Pricing
View Details