ZNF746 Peptide - N-terminal region
ZNF746 Peptide - N-terminal region
Product Specifications
UniProt
Q6NUN9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF746 Rabbit Polyclonal Antibody (orb577216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1183-5mg 5 mg
Mouse Anti-Mouse PD-L1 (10F.9G2) Recombinant Antibody
Sign In for Pricing
View Details 
BNC473179-100 1x 100 µL
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH033604-01 10 µg
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 22-259, Fc Tag)
Sign In for Pricing
View Details PKSH033604-02 50 µg
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 22-259, Fc Tag)
Sign In for Pricing
View Details 