Pard6b Peptide - N-terminal region
Pard6b Peptide - N-terminal region
Product Specifications
Product Name Alternative
AV025615, Par6b
UniProt
Q9JK83
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pard6b Rabbit Polyclonal Antibody (orb578646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067384
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042096-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
